PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G546700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GATA
Protein Properties Length: 234aa    MW: 24383.3 Da    PI: 8.0047
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G546700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.64e-19135168134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         C++Cg+ +Tp+WR+gp g++tLCnaCG+++++ +
  Sevir.9G546700.1.p 135 CTHCGSEETPQWRQGPAGPSTLCNACGVRFKSGR 168
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.7E-16129183IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308129165IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-15132193No hitNo description
Gene3DG3DSA:3.30.50.107.6E-15133166IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.44E-16134183No hitNo description
PfamPF003209.2E-17135168IPR000679Zinc finger, GATA-type
PROSITE patternPS003440135160IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MAGGGAADEN PAAAAVPDEL GGGADASLNA FFDHAGLELA AVGGGQGPEE EEELEWLSNM  60
DAFPSVETMA AEVVAEAAPS RPSAGLGRLE ALPHVVGPRT KGLRRRRRVT APWSLPPVLP  120
PAPPPAGGAA PRRRCTHCGS EETPQWRQGP AGPSTLCNAC GVRFKSGRLF PEYRPINSPT  180
FSPLLHSNSH RRVLEMRRHV EEEAAAGGIR AGARARRAER AAARAAASSD QSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0184181e-121BT018418.1 Zea mays clone EL01N0356F04.d mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987179.11e-163PREDICTED: GATA transcription factor 7
TrEMBLK7WH515e-80K7WH51_MAIZE; Putative GATA transcription factor family protein
STRINGGRMZM2G532534_P012e-79(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-34GATA transcription factor 1